PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo29G0021100
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family MYB
Protein Properties Length: 211aa    MW: 23728.6 Da    PI: 9.1582
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo29G0021100genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.42.9e-171057148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT +Ed++lv+ v +lG+++W++Ia+  g++R++k+c++rw +yl
  Spipo29G0021100 10 KGPWTGQEDLRLVCFVGLLGNRRWDAIAKVSGLRRSGKSCRLRWVNYL 57
                     79********************************************97 PP

2Myb_DNA-binding53.65.3e-1763106146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rgr+ ++E+ l+vd+++++G++ W++Ia++++ gRt++++k++w++
  Spipo29G0021100  63 RGRMNPQEERLIVDLHARWGNR-WSRIAKRLP-GRTDNEIKNYWRT 106
                      89********************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.025557IPR017930Myb domain
SMARTSM007171.3E-13959IPR001005SANT/Myb domain
SuperFamilySSF466896.74E-279104IPR009057Homeodomain-like
PfamPF002491.1E-151057IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-181164IPR009057Homeodomain-like
CDDcd001671.82E-91257No hitNo description
PROSITE profilePS5129425.00458112IPR017930Myb domain
SMARTSM007172.8E-1562110IPR001005SANT/Myb domain
PfamPF002495.5E-1563106IPR001005SANT/Myb domain
CDDcd001671.06E-1065106No hitNo description
Gene3DG3DSA:1.10.10.604.5E-2365111IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 211 aa     Download sequence    Send to blast
MVMVREETRK GPWTGQEDLR LVCFVGLLGN RRWDAIAKVS GLRRSGKSCR LRWVNYLRPG  60
LKRGRMNPQE ERLIVDLHAR WGNRWSRIAK RLPGRTDNEI KNYWRTRMRK KAQEKGTSTS  120
SPILSSSSSD KPGEEDSHEL HGGGGGAPAT PLDQTWNESA PSTMSESTLH EAWCYSGESL  180
WKIDDDEGDF GLALPTVDLS GPSYYHGMEP *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A1e-2771121105MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010905710.17e-78PREDICTED: myb-related protein MYBAS2-like isoform X1
SwissprotQ4JL761e-67MYBA2_ORYSJ; Myb-related protein MYBAS2
TrEMBLB6TH071e-70B6TH07_MAIZE; MYB59
STRINGSb08g018580.18e-70(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP63637169
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59780.35e-64myb domain protein 59